PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.28487s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 395aa    MW: 44544.1 Da    PI: 7.3943
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.28487s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.8e-344599155
               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                          kprl+Wtp+LHerF+eav+qLGG++kAtPkti+++m+++gLtl+h+kSHLQkYRl
  Araha.28487s0001.1.p 45 KPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 99
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.22742102IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3143100IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2345100IPR006447Myb domain, plants
PfamPF002494.6E-104798IPR001005SANT/Myb domain
PfamPF143791.3E-25147192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MYYQNQQQGK NILSSSRMHI TSERHPFLRG NSPGDSGLIL STDAKPRLKW TPDLHERFIE  60
AVNQLGGADK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANSS FNKIGMMTML  120
EEQTPDADEI QSESLSIGPQ PNKNSPIGEA LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK  180
YLQSVLEKAQ ETLGKQNLGA AGIEAAKVQL SELVSKVSAE YPNSSILEPK ELQNLCSQQM  240
QTTYPPDCSL ESCLTSSEGT QKNLKMLENN RLGLRTYLGD STSEQKEIME EQLFQRRELT  300
WTEGLRGNPY LSAMVSEAEQ RISYSERSPG RLSIGVGLHG HKSQHQQGNN EDHKFETRSR  360
KGMDSTTELD LNTHVENFCT KRTKQFDLNG FSWN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2220890.0HQ222089.1 Arabidopsis thaliana myb family transcription factor (MYR2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884424.10.0predicted protein
TrEMBLD7L2090.0D7L209_ARALL; Predicted protein
STRINGAl_scaffold_0003_3520.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.30.0G2-like family protein